DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and Dnajb12

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001013929.1 Gene:Dnajb12 / 294513 RGDID:1359677 Length:378 Species:Rattus norvegicus


Alignment Length:66 Identity:33/66 - (50%)
Similarity:47/66 - (71%) Gaps:5/66 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKN--PDNVDAADKFKEVNRAHSILSDQTKRNIYDNY 81
            |||||:.::|:.:|:||.|||||||:|||||  |   .|.:.||.:..|:::||:..||..||.:
  Rat   113 YEILGVSRSASDEDLKKAYRKLALKFHPDKNHAP---GATEAFKAIGTAYAVLSNPEKRKQYDQF 174

  Fly    82 G 82
            |
  Rat   175 G 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 30/61 (49%)
Dnajb12NP_001013929.1 DnaJ_bact 111..>237 CDD:274090 33/66 (50%)
DUF1977 269..367 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.