DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and DNAJC5G

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001290056.1 Gene:DNAJC5G / 285126 HGNCID:24844 Length:189 Species:Homo sapiens


Alignment Length:180 Identity:82/180 - (45%)
Similarity:105/180 - (58%) Gaps:33/180 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KLSTSGDSLYEILGLPKTATGDDIKKTY----------------RKLALKYHPDKNPDNVDAADK 58
            :||.|..|||.:|.|.|.|:.:|.||:|                |||||:|||||||.|..||:.
Human    10 RLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRYHPDKNPGNAQAAEI 74

  Fly    59 FKEVNRAHSILSDQTKRNIYDNYGSLGLYIAEQFGEENVNAYFVVTSPAVKAVVICCAVITGCCC 123
            |||:|.||:||||..||.|||.:||||:|:.:.||||.|..||::.|...|.:||.|.::|   |
Human    75 FKEINAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRYYFILNSCWFKTLVILCTLLT---C 136

  Fly   124 CCCCCCCCNFCCGKFKPPVNESHDQYSHLNRPDGNREGNDMPTHLGQPPR 173
            ||.||||| ||||..|||..:.          .|.:...::.:   ||||
Human   137 CCFCCCCC-FCCGALKPPPEQD----------SGRKYQQNVQS---QPPR 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 44/84 (52%)
DnaJ 17..79 CDD:278647 39/77 (51%)
DNAJC5GNP_001290056.1 DnaJ 13..>98 CDD:223560 42/84 (50%)
DnaJ 17..95 CDD:278647 39/77 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..189 5/32 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156749
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1401920at2759
OrthoFinder 1 1.000 - - FOG0001454
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR44027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X732
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.