DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and DNAJB5

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001128477.1 Gene:DNAJB5 / 25822 HGNCID:14887 Length:420 Species:Homo sapiens


Alignment Length:231 Identity:63/231 - (27%)
Similarity:82/231 - (35%) Gaps:94/231 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKR 75
            ::..|...|:|||:|..|..|:|||.|||:|||||||||.: .:|.:||||:..|:.:|||..||
Human    70 VAVMGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKE-PNAEEKFKEIAEAYDVLSDPKKR 133

  Fly    76 NIYDNYGSLGL------------------------YIAEQFGEENVNAYFVVTSPAVKAVVICCA 116
            .:||.||..||                        ..|..||..|....|..:|.:         
Human   134 GLYDQYGEEGLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRS--------- 189

  Fly   117 VITGCCCCCCCCCCCNFCCGKFKPPVNESHDQYSHLNRPDGNREGNDMPTHLGQPPRLEDVDLDD 181
                                                .||....:.:||           |||.|:
Human   190 ------------------------------------TRPFSGFDPDDM-----------DVDEDE 207

  Fly   182 VNLGAGG-------------APVTSQPREQAGGQPV 204
            ...||.|             ||....||.:....||
Human   208 DPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 37/68 (54%)
DnaJ 17..79 CDD:278647 33/61 (54%)
DNAJB5NP_001128477.1 DnaJ 72..415 CDD:223560 63/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.