DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dph4

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_594366.1 Gene:dph4 / 2543534 PomBaseID:SPAC926.05C Length:139 Species:Schizosaccharomyces pombe


Alignment Length:139 Identity:40/139 - (28%)
Similarity:52/139 - (37%) Gaps:54/139 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLP--KTATGDDIKKTYRKLALKYHPDK---NPDNVDAADKFKEVNRAHSILSDQTKRNIY 78
            |.:|.|.  ||.|.|:||:.|||..|.:||||   .|..|...|:.||   |:.:||.:..|..|
pombe     4 YSVLNLKDGKTYTDDEIKEAYRKALLLFHPDKCKEKPSVVYTIDQVKE---AYQVLSSEKDRQQY 65

  Fly    79 -----------------------DN--------YGSLGLYIAEQFGEENVNAYFVVTSPAVKAVV 112
                                   ||        .|.||.|:..:...||           .::||
pombe    66 QIKQEEESSHYYSIVDLSEFEELDNGSYYYPCRCGDLGGYVVTEDDLEN-----------NRSVV 119

  Fly   113 ICCAVITGC 121
            .|    .||
pombe   120 PC----MGC 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 27/87 (31%)
dph4NP_594366.1 DnaJ 2..65 CDD:395170 26/63 (41%)
zf-CSL 78..133 CDD:398744 13/62 (21%)

Return to query results.
Submit another query.