DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and mug185

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_593763.1 Gene:mug185 / 2542938 PomBaseID:SPAC6B12.08 Length:380 Species:Schizosaccharomyces pombe


Alignment Length:74 Identity:29/74 - (39%)
Similarity:44/74 - (59%) Gaps:5/74 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNYGS 83
            ||||.:...:...:||..||||||:||||:||...|..:.|.::|.|::|||:..||..::..  
pombe    11 YEILQVNHDSDLQEIKANYRKLALQYHPDRNPGIEDYNEIFSQINAAYNILSNDDKRKWHEKD-- 73

  Fly    84 LGLYIAEQF 92
               |:..|:
pombe    74 ---YLRNQY 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 27/66 (41%)
DnaJ 17..79 CDD:278647 27/59 (46%)
mug185NP_593763.1 DnaJ 9..71 CDD:278647 27/59 (46%)
zf-C2H2_2 <260..314 CDD:289522
zf-C2H2_jaz 272..295 CDD:288983
C2H2 Zn finger 272..294 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.