DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and mug184

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_595124.1 Gene:mug184 / 2540016 PomBaseID:SPBC1773.09c Length:551 Species:Schizosaccharomyces pombe


Alignment Length:81 Identity:38/81 - (46%)
Similarity:46/81 - (56%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNP-DNVDAADKFKEVNRAHSILSDQTKRN 76
            ||.| .|.||.|.|.||...|:|.|..|||:||||:|| |...|..:|:.:..||.:|||.|||.
pombe     9 TSVD-YYAILKLQKNATFQQIRKQYLFLALQYHPDRNPGDEERAVKRFQRLQLAHEVLSDATKRL 72

  Fly    77 IYDNYGSLGLYIAEQF 92
            |||....|......|:
pombe    73 IYDQLFGLSTRTRSQY 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 34/69 (49%)
DnaJ 17..79 CDD:278647 31/62 (50%)
mug184NP_595124.1 DnaJ 11..>79 CDD:223560 34/68 (50%)
DnaJ 12..75 CDD:278647 32/63 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.