Protein Alignment Csp and Dnajb6

DIOPT Version :9

• Sequence 1: NP_001287144.1
• Gene: Csp / 40459
• FlyBaseID: FBgn0004179
• Length: 249
• Species: Drosophila melanogaster
• Sequence 2: NP_001365764.1
• Gene: Dnajb6 / 23950
• MGIID: 1344381
• Length: 372
• Species: Mus musculus
• Alignment Length: 69
• Identity: 40/69 - (57%)
• Similarity: 53/69 - (76%)
• Gaps: 1/69 - (1%)

  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAAD-KFKEVNRAHSILSDQTKRNIYDNYG 82
            ||:||:.:.|:.:||||.|||.|||:||||||:|.:.|: |||:|..|:.:|||..||:|||.||
Mouse     5 YEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYG 69

  Fly    83 SLGL 86
            ..||
Mouse    70 KEGL 73

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
Csp	NP_001287144.1	DnaJ	17..>86	CDD:223560	38/67 (57%)
		DnaJ	17..79	CDD:278647	34/60 (57%)
Dnajb6	NP_001365764.1	Interaction with HSP70. /evidence=ECO:0000250	1..147		40/69 (58%)
		DnaJ	2..>138	CDD:223560	40/69 (58%)
		Interaction with KRT18. /evidence=ECO:0000250	120..235

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910