DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and Dnajc16

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_758841.1 Gene:Dnajc16 / 214063 MGIID:2442146 Length:772 Species:Mus musculus


Alignment Length:90 Identity:39/90 - (43%)
Similarity:57/90 - (63%) Gaps:8/90 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNYGS 83
            |.:||:.:||:..||||.|:|||.::|||||.| ..|.|:|.::::|:.|||::.||..||:||.
Mouse    31 YRVLGVSRTASQADIKKAYKKLAREWHPDKNKD-PGAEDRFIQISKAYEILSNEEKRTNYDHYGD 94

  Fly    84 LGL---YIAEQ----FGEENVNAYF 101
            .|.   |..:|    |...:.|.||
Mouse    95 AGENQGYQKQQREHRFRHFHENFYF 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 32/66 (48%)
DnaJ 17..79 CDD:278647 28/59 (47%)
Dnajc16NP_758841.1 DnaJ 29..>135 CDD:223560 39/90 (43%)
TRX_DnaJ 134..243 CDD:239261
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 560..591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.