DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and DNAJC18

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_689899.1 Gene:DNAJC18 / 202052 HGNCID:28429 Length:358 Species:Homo sapiens


Alignment Length:66 Identity:34/66 - (51%)
Similarity:45/66 - (68%) Gaps:5/66 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKN--PDNVDAADKFKEVNRAHSILSDQTKRNIYDNY 81
            |||||:.:.|:.:::||.|||||||:|||||  |   .|.|.||.:..|.::||:..||..||.|
Human    84 YEILGVSRDASDEELKKAYRKLALKFHPDKNCAP---GATDAFKAIGNAFAVLSNPDKRLRYDEY 145

  Fly    82 G 82
            |
Human   146 G 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 30/61 (49%)
DNAJC18NP_689899.1 DnaJ_bact 83..>187 CDD:274090 34/66 (52%)
DUF1977 250..348 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.