powered by:
Protein Alignment Csp and dnj-3
DIOPT Version :9
Sequence 1: | NP_001287144.1 |
Gene: | Csp / 40459 |
FlyBaseID: | FBgn0004179 |
Length: | 249 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_506711.1 |
Gene: | dnj-3 / 182084 |
WormBaseID: | WBGene00001021 |
Length: | 191 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 22/73 - (30%) |
Similarity: | 36/73 - (49%) |
Gaps: | 12/73 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 YEILGLPKTATGDDIKKTYRKLALKYHPD------KNPDNVDAA------DKFKEVNRAHSILSD 71
|||:|:..:||..:|:..:.|...:.||| |:...|..| ::|..|..|:.:|.:
Worm 20 YEIIGVSASATRQEIRDAFLKKTKQLHPDQSRKSSKSDSRVGWATGSSETEQFMLVKEAYDVLRN 84
Fly 72 QTKRNIYD 79
:.||..||
Worm 85 EEKRKEYD 92
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.