DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnj-14

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001257015.1 Gene:dnj-14 / 180746 WormBaseID:WBGene00001032 Length:217 Species:Caenorhabditis elegans


Alignment Length:218 Identity:84/218 - (38%)
Similarity:109/218 - (50%) Gaps:41/218 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 APGMDKRKLSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPD-NVDAADKFKEVNRAH 66
            :|..|.......|..||.:||:.|.||.|:|||.||||||:||||||.| :.:..:.|||:|.|:
 Worm    24 SPAADHSHDPKKGLHLYNVLGIQKNATDDEIKKAYRKLALRYHPDKNLDGDPEKTEMFKEINYAN 88

  Fly    67 SILSDQTKRNIYDNYGSLGLYIAEQFGEENVNAYFVVTSPAVKAVVICCAVITG---CCCC---C 125
            ::||:..||.:||..|..||.:.|||||:.....::: .|..|.......::||   ||||   |
 Worm    89 AVLSNPNKRRVYDEMGETGLKLMEQFGEDEKILQWML-KPWFKWTFFAFGLLTGGFFCCCCGCMC 152

  Fly   126 CCCCCCNFCCGKFKPPVNESHDQYSHLNRPDGNREGNDMPTHLGQPPRLEDVDLDDVNLGAGGAP 190
            ||.|||||||||:||    .||........||                  ||.:|.        |
 Worm   153 CCQCCCNFCCGKYKP----KHDDEFADETSDG------------------DVIVDQ--------P 187

  Fly   191 VTSQPREQAGGQP---VFAMPPP 210
            ..|:|......:.   |.|||||
 Worm   188 TASEPMPDTNNRQVPIVIAMPPP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 36/69 (52%)
DnaJ 17..79 CDD:278647 33/62 (53%)
dnj-14NP_001257015.1 DnaJ 39..101 CDD:365959 33/61 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159948
Domainoid 1 1.000 79 1.000 Domainoid score I5632
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I3047
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1401920at2759
OrthoFinder 1 1.000 - - FOG0001454
OrthoInspector 1 1.000 - - oto18449
orthoMCL 1 0.900 - - OOG6_105499
Panther 1 1.100 - - LDO PTHR44027
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3080
SonicParanoid 1 1.000 - - X732
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.