DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and Dnajc5

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001258513.1 Gene:Dnajc5 / 13002 MGIID:892995 Length:198 Species:Mus musculus


Alignment Length:239 Identity:113/239 - (47%)
Similarity:135/239 - (56%) Gaps:46/239 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KRKLSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQ 72
            :|.|||||:|||.:|||.|.||.|||||:||||||||||||||||.:|||||||:|.||:||:|.
Mouse     6 QRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDA 70

  Fly    73 TKRNIYDNYGSLGLYIAEQFGEENVNAYFVVTSPAVKAVVICCAVITGCCCCCCCCCCCNFCCGK 137
            |||||||.|||||||:||||||||||.|||::|...||:.:.|.::|.|.||||.|||.|.||||
Mouse    71 TKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVVCGLLTCCYCCCCLCCCFNCCCGK 135

  Fly   138 FKPPVNESHDQYSHLNRPDGNREGNDMPTHLGQPPRLEDVDLDDVNLGAGGAPVTSQPREQAGGQ 202
            .||...|..:...:::                 |..||             |.:.|..||...  
Mouse   136 CKPKAPEGEETEFYVS-----------------PEDLE-------------AQLQSDEREATD-- 168

  Fly   203 PVFAMPPPSGAVGVNPFTGAPVAANENTSLNTTEQTTYTPDMVN 246
                          .|....|.:|.|.|.|......:|..|..|
Mouse   169 --------------TPIVIQPASATETTQLTADSHPSYHTDGFN 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 54/68 (79%)
DnaJ 17..79 CDD:278647 48/61 (79%)
Dnajc5NP_001258513.1 DnaJ 15..>84 CDD:223560 54/68 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 106 1.000 Domainoid score I6606
eggNOG 1 0.900 - - E2759_KOG0716
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9631
Inparanoid 1 1.050 217 1.000 Inparanoid score I3585
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001454
OrthoInspector 1 1.000 - - otm43357
orthoMCL 1 0.900 - - OOG6_105499
Panther 1 1.100 - - O PTHR44027
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3080
SonicParanoid 1 1.000 - - X732
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.