DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and shv

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_317136.5 Gene:shv / 1277658 VectorBaseID:AGAMI1_011309 Length:359 Species:Anopheles gambiae


Alignment Length:69 Identity:36/69 - (52%)
Similarity:50/69 - (72%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIY 78
            :|...|:||||.|||:.:|:||.|||||.:.|||||.|:.||:.||:::..|:.:|||..||.:|
Mosquito    26 AGRDFYKILGLRKTASKNDVKKAYRKLAKELHPDKNKDDPDASQKFQDLGAAYEVLSDDDKRKLY 90

  Fly    79 DNYG 82
            |..|
Mosquito    91 DRCG 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 32/61 (52%)
shvXP_317136.5 None

Return to query results.
Submit another query.