DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and zgc:152986

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001275586.1 Gene:zgc:152986 / 101884054 ZFINID:ZDB-GENE-061013-762 Length:177 Species:Danio rerio


Alignment Length:66 Identity:28/66 - (42%)
Similarity:41/66 - (62%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNYGS 83
            |.:||:.:..:..||||.:.|||||:||||| ...:|...|..:.:|:.:|||:.||.:||....
Zfish    24 YSVLGVSRFVSSRDIKKAFHKLALKHHPDKN-QTPNAQQTFTHIAQAYEVLSDREKRRVYDQMDH 87

  Fly    84 L 84
            |
Zfish    88 L 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 25/59 (42%)
zgc:152986NP_001275586.1 terminal_TopJ 22..>177 CDD:468284 28/66 (42%)
DnaJ 22..83 CDD:395170 25/59 (42%)

Return to query results.
Submit another query.