DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnajc12

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_002936903.1 Gene:dnajc12 / 100493658 XenbaseID:XB-GENE-989011 Length:187 Species:Xenopus tropicalis


Alignment Length:63 Identity:21/63 - (33%)
Similarity:36/63 - (57%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNY 81
            |.:||..:.:|.:.|...|:..||:.||||:|.|..|.:.|:.:.:|...|:::..|..||.:
 Frog    15 YSLLGCDELSTVEQILAEYKVRALECHPDKHPGNKKAVEDFQRLQQAKETLTNEESRAHYDQW 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 19/59 (32%)
dnajc12XP_002936903.1 DnaJ 13..75 CDD:395170 19/59 (32%)

Return to query results.
Submit another query.