DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and DNAJB6

DIOPT Version :9

Sequence 1:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_005249572.1 Gene:DNAJB6 / 10049 HGNCID:14888 Length:334 Species:Homo sapiens


Alignment Length:69 Identity:41/69 - (59%)
Similarity:54/69 - (78%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAAD-KFKEVNRAHSILSDQTKRNIYDNYG 82
            ||:||:.:.|:.:||||.|||||||:||||||:|.:.|: |||:|..|:.:|||..||:|||.||
Human     5 YEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYG 69

  Fly    83 SLGL 86
            ..||
Human    70 KEGL 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 39/67 (58%)
DnaJ 17..79 CDD:278647 35/60 (58%)
DNAJB6XP_005249572.1 DnaJ 2..>106 CDD:223560 41/69 (59%)
DnaJ 3..66 CDD:278647 35/60 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.