DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnajb12b

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001429524.1 Gene:dnajb12b / 100037354 ZFINID:ZDB-GENE-070410-128 Length:369 Species:Danio rerio


Alignment Length:79 Identity:39/79 - (49%)
Similarity:49/79 - (62%) Gaps:16/79 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKN--PDNVDAADKFKEVNRAHSILSDQTKRNIYDNY 81
            |||||:.|.|:.||:||.|||||||:|||||  |   .|.:.||.:..|:::||:..||..||  
Zfish   111 YEILGVQKDASEDDLKKAYRKLALKFHPDKNHAP---GATEAFKAIGNAYAVLSNGEKRRQYD-- 170

  Fly    82 GSLGLYIAEQFGEE 95
                     |||||
Zfish   171 ---------QFGEE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 32/61 (52%)
dnajb12bNP_001429524.1 None

Return to query results.
Submit another query.