DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11523 and Gskip

DIOPT Version :9

Sequence 1:NP_649386.1 Gene:CG11523 / 40458 FlyBaseID:FBgn0037156 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_848728.2 Gene:Gskip / 66787 MGIID:1914037 Length:144 Species:Mus musculus


Alignment Length:116 Identity:35/116 - (30%)
Similarity:58/116 - (50%) Gaps:16/116 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESATCCVQVSSRGFKIVSSQYDTIDEDSR 85
            ||.|::|||...|..:.:|..:.......|:|:.|.|....|::::..|.::|...:|.::    
Mouse    41 EAEAVVNDVLFAVNHMFVSKSMPCADDVAYINVETKERNRYCLELTEAGLRVVGYAFDQVE---- 101

  Fly    86 ISALLRNGQEQGDDEEEEIFETPYALLDKISPRYVESFGNQLCQQLRALQQ 136
                        |..:....||.|:|||.:||.|.|:|||.|.|:|.||::
Mouse   102 ------------DHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11523NP_649386.1 DUF727 18..134 CDD:283065 33/112 (29%)
GskipNP_848728.2 DUF727 38..138 CDD:283065 33/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845959
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3965
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48308
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107811
Panther 1 1.100 - - LDO PTHR12490
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3011
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.740

Return to query results.
Submit another query.