| Sequence 1: | NP_649386.1 | Gene: | CG11523 / 40458 | FlyBaseID: | FBgn0037156 | Length: | 158 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001258833.1 | Gene: | GSKIP / 51527 | HGNCID: | 20343 | Length: | 139 | Species: | Homo sapiens |
| Alignment Length: | 116 | Identity: | 38/116 - (32%) |
|---|---|---|---|
| Similarity: | 58/116 - (50%) | Gaps: | 16/116 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 21 EANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESATCCVQVSSRGFKIVSSQYDTIDEDSR 85
Fly 86 ISALLRNGQEQGDDEEEEIFETPYALLDKISPRYVESFGNQLCQQLRALQQ 136 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG11523 | NP_649386.1 | DUF727 | 18..134 | CDD:283065 | 36/112 (32%) |
| GSKIP | NP_001258833.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..22 | ||
| DUF727 | 33..133 | CDD:398795 | 36/112 (32%) | ||
| Required for PRKAR2A interaction, contributes to a protective effect against H(2)O(2)-induced apoptosis. /evidence=ECO:0000269|PubMed:25920809 | 41..45 | 2/3 (67%) | |||
| Interaction with GSK3B and acts as GSK3B inhibitor. /evidence=ECO:0000269|PubMed:16981698 | 115..139 | 12/21 (57%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165155507 | |
| Domainoid | 1 | 1.000 | 65 | 1.000 | Domainoid score | I10060 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG3965 | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 66 | 1.000 | Inparanoid score | I5358 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG48308 | |
| OrthoDB | 1 | 1.010 | - | - | D1508955at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0005233 | |
| OrthoInspector | 1 | 1.000 | - | - | oto88347 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_107811 | |
| Panther | 1 | 1.100 | - | - | LDO | PTHR12490 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3011 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 15 | 14.800 | |||||