DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11523 and gskip

DIOPT Version :9

Sequence 1:NP_649386.1 Gene:CG11523 / 40458 FlyBaseID:FBgn0037156 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_021322813.1 Gene:gskip / 406744 ZFINID:ZDB-GENE-040426-2777 Length:147 Species:Danio rerio


Alignment Length:116 Identity:37/116 - (31%)
Similarity:61/116 - (52%) Gaps:16/116 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESATCCVQVSSRGFKIVSSQYDTIDEDSR 85
            ||.|::|||...|:::.:|..|:|.....|:|:.|.|....|::::..|.::|...:|.::    
Zfish    45 EAEAVVNDVLFAVSDMHVSHNLSSGLDVAYINVETREGNRYCLELTEAGLRVVGHTFDKVN---- 105

  Fly    86 ISALLRNGQEQGDDEEEEIFETPYALLDKISPRYVESFGNQLCQQLRALQQ 136
                        |....:..||.|:|||.:||.|.|:|||.|.|:|..|:|
Zfish   106 ------------DGLSSQYHETVYSLLDSLSPGYREAFGNALLQRLERLKQ 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11523NP_649386.1 DUF727 18..134 CDD:283065 35/112 (31%)
gskipXP_021322813.1 DUF727 42..142 CDD:310132 35/112 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590670
Domainoid 1 1.000 67 1.000 Domainoid score I9887
eggNOG 1 0.900 - - E1_KOG3965
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5322
OMA 1 1.010 - - QHG48308
OrthoDB 1 1.010 - - D1508955at2759
OrthoFinder 1 1.000 - - FOG0005233
OrthoInspector 1 1.000 - - oto41767
orthoMCL 1 0.900 - - OOG6_107811
Panther 1 1.100 - - LDO PTHR12490
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3011
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.