DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11523 and Y43F8B.2

DIOPT Version :9

Sequence 1:NP_649386.1 Gene:CG11523 / 40458 FlyBaseID:FBgn0037156 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_507796.1 Gene:Y43F8B.2 / 180278 WormBaseID:WBGene00012813 Length:317 Species:Caenorhabditis elegans


Alignment Length:143 Identity:41/143 - (28%)
Similarity:69/143 - (48%) Gaps:26/143 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ADPGEEQAFNCEDEANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESATCCVQVSSRGFKI 72
            |..|.|.:.  |.||.|.::::...|..|.:|..|......|::|:.|:|:...|::::.:|::|
 Worm   148 ASRGGESSL--ELEAIAAVHELSFAVQSISVSEMLPRTPDLIFVNVTTLEAQPYCLELTLKGWRI 210

  Fly    73 VSSQYDTIDEDSRISALLRNGQEQGDDEEEEIF----ETPYALLDKISPRYVESFGNQLCQQLRA 133
            .|               ||:....||....|:|    ::.|.|:|.|||.|.|.|..:|.|:|:.
 Worm   211 TS---------------LRSDCMVGDFTRLELFTKYYDSLYLLMDDISPGYRERFSEKLVQRLKL 260

  Fly   134 LQQMRTEFNEEDE 146
            :     |..|||:
 Worm   261 I-----EAGEEDQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11523NP_649386.1 DUF727 18..134 CDD:283065 34/119 (29%)
Y43F8B.2NP_507796.1 DUF727 156..259 CDD:368379 33/119 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164081
Domainoid 1 1.000 54 1.000 Domainoid score I7503
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508955at2759
OrthoFinder 1 1.000 - - FOG0005233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107811
Panther 1 1.100 - - O PTHR12490
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3011
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.