DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11523 and T24H7.3

DIOPT Version :9

Sequence 1:NP_649386.1 Gene:CG11523 / 40458 FlyBaseID:FBgn0037156 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_495248.1 Gene:T24H7.3 / 174032 WormBaseID:WBGene00020782 Length:156 Species:Caenorhabditis elegans


Alignment Length:125 Identity:34/125 - (27%)
Similarity:69/125 - (55%) Gaps:11/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EDEANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESATCCVQVSSRGFKIVSSQYDTIDED 83
            |:||.|.:.:....|..|.:|..|...:..:::|:.|.|:.|.|::::.:|:::.|::.|.:   
 Worm    43 EEEAMAAVRENAFAVNLIGVSEMLPRTSQLLFINVTTFENHTHCIELTQKGWRVASNRNDCM--- 104

  Fly    84 SRISALLRNGQEQGDDEEEEIFETPYALLDKISPRYVESFGNQLCQQLRALQQMRTEFNE 143
                    ||..:..|...:.||:.:.||..|||.:.|:||::|..:|..|::.|::.:|
 Worm   105 --------NGDFRQLDIHTKYFESLHTLLMDISPLFRETFGSKLISKLSELKKERSDSDE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11523NP_649386.1 DUF727 18..134 CDD:283065 31/114 (27%)
T24H7.3NP_495248.1 DUF727 42..147 CDD:368379 31/114 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164083
Domainoid 1 1.000 54 1.000 Domainoid score I7503
eggNOG 1 0.900 - - E1_KOG3965
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I4034
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48308
OrthoDB 1 1.010 - - D1508955at2759
OrthoFinder 1 1.000 - - FOG0005233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107811
Panther 1 1.100 - - O PTHR12490
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3011
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.