powered by:
Protein Alignment Rich and AT5G28442
DIOPT Version :9
Sequence 1: | NP_001262205.1 |
Gene: | Rich / 40456 |
FlyBaseID: | FBgn0028500 |
Length: | 1429 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001190415.1 |
Gene: | AT5G28442 / 10723119 |
AraportID: | AT5G28442 |
Length: | 84 |
Species: | Arabidopsis thaliana |
Alignment Length: | 73 |
Identity: | 21/73 - (28%) |
Similarity: | 36/73 - (49%) |
Gaps: | 8/73 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MYYPVGWPKRVGLALPGESASIRHICCDAVKI---LVAAVGDDFLGIW-YANPLIPIAYFRRTED 61
||...|||:.:.| |||...|::.:. .:|: |:..|....|.:| .:...:.:..:.|.:.
plant 1 MYMAYGWPQVIPL-LPGSCPSLQRVV--YLKLSGQLLLVVSPSHLELWGSSQQRVRLGKYMRDDK 62
Fly 62 SLRQYGAN 69
|||: |.|
plant 63 SLRE-GEN 69
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Rich | NP_001262205.1 |
WD40 repeat |
265..312 |
CDD:293791 |
|
RIC1 |
713..974 |
CDD:284476 |
|
AT5G28442 | NP_001190415.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2006 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D261419at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003567 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.