DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rich and AT5G28442

DIOPT Version :9

Sequence 1:NP_001262205.1 Gene:Rich / 40456 FlyBaseID:FBgn0028500 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001190415.1 Gene:AT5G28442 / 10723119 AraportID:AT5G28442 Length:84 Species:Arabidopsis thaliana


Alignment Length:73 Identity:21/73 - (28%)
Similarity:36/73 - (49%) Gaps:8/73 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYYPVGWPKRVGLALPGESASIRHICCDAVKI---LVAAVGDDFLGIW-YANPLIPIAYFRRTED 61
            ||...|||:.:.| |||...|::.:.  .:|:   |:..|....|.:| .:...:.:..:.|.:.
plant     1 MYMAYGWPQVIPL-LPGSCPSLQRVV--YLKLSGQLLLVVSPSHLELWGSSQQRVRLGKYMRDDK 62

  Fly    62 SLRQYGAN 69
            |||: |.|
plant    63 SLRE-GEN 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RichNP_001262205.1 WD40 repeat 265..312 CDD:293791
RIC1 713..974 CDD:284476
AT5G28442NP_001190415.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D261419at2759
OrthoFinder 1 1.000 - - FOG0003567
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.