DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP0 and MRT4

DIOPT Version :9

Sequence 1:NP_001262202.1 Gene:RpLP0 / 40451 FlyBaseID:FBgn0000100 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_012916.1 Gene:MRT4 / 853860 SGDID:S000001492 Length:236 Species:Saccharomyces cerevisiae


Alignment Length:218 Identity:64/218 - (29%)
Similarity:102/218 - (46%) Gaps:35/218 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMMRKAI-- 65
            |||    |.:.|.:|.|..|.:...:::..|:|.:..:|.||||..| :.::|||..:::||:  
Yeast    20 REN----KERIFDEVREALDTYRYVWVLHLDDVRTPVLQEIRTSWAG-SKLIMGKRKVLQKALGE 79

  Fly    66 ---RGHLENNPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAP-ARPGAIAPLHVI---- 122
               ..:.||..||.||   ..|..|.:||..|:..|:: ..:|.||:. :||...|||...    
Yeast    80 KREEEYKENLYQLSKL---CSGVTGLLFTDEDVNTVKE-YFKSYVRSDYSRPNTKAPLTFTIPEG 140

  Fly   123 --------IPAQNT-----GLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATL 174
                    |||:..     .|.|...:.|:   |||||..|.|.|.:...:...|:|:...:|.:
Yeast   141 IVYSRGGQIPAEEDVPMIHSLEPTMRNKFE---IPTKIKAGKITIDSPYLVCTEGEKLDVRQALI 202

  Fly   175 LNMLNISPFSYGLIVNQVYDSGS 197
            |....|:...:.:.|:..||:.|
Yeast   203 LKQFGIAASEFKVKVSAYYDNDS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP0NP_001262202.1 PTZ00135 1..275 CDD:240285 64/218 (29%)
Ribosomal_P0_L10e 8..182 CDD:240221 57/196 (29%)
Ribosomal_60s 232..>285 CDD:278836
MRT4NP_012916.1 Ribosomal_P0_like 21..196 CDD:240222 56/186 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.