DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP0 and EMB3136

DIOPT Version :9

Sequence 1:NP_001262202.1 Gene:RpLP0 / 40451 FlyBaseID:FBgn0000100 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_196855.1 Gene:EMB3136 / 831195 AraportID:AT5G13510 Length:220 Species:Arabidopsis thaliana


Alignment Length:121 Identity:30/121 - (24%)
Similarity:54/121 - (44%) Gaps:26/121 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRENKAAWKAQYFIKVVELFDEFPKCFIVGADN---VGSKQMQNIRTSLRGLAVVLMGKNTMMR 62
            ::|...:..|.:..::.|:  .....|.::.|.|   :..||.|::|.:|.....:::.|||::.
plant    38 VIRSAVSRNKKEETVEAVK--SHLENCHLLAAINYKGLTVKQFQDLRRTLPDTTKLIVAKNTLVF 100

  Fly    63 KAIRGHLENNPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAP 118
            |||.|     .:.|.|.|.:||...::|.:.|  |:              |.||.|
plant   101 KAIEG-----TKWEALKPCMKGMNAWLFVQTD--EI--------------PSAIKP 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP0NP_001262202.1 PTZ00135 1..275 CDD:240285 30/121 (25%)
Ribosomal_P0_L10e 8..182 CDD:240221 29/114 (25%)
Ribosomal_60s 232..>285 CDD:278836
EMB3136NP_196855.1 Ribosomal_L10 44..201 CDD:240223 29/115 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.