DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP0 and MRTO4

DIOPT Version :9

Sequence 1:NP_001262202.1 Gene:RpLP0 / 40451 FlyBaseID:FBgn0000100 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_057267.2 Gene:MRTO4 / 51154 HGNCID:18477 Length:239 Species:Homo sapiens


Alignment Length:208 Identity:48/208 - (23%)
Similarity:88/208 - (42%) Gaps:27/208 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LFDEFPKC-------FIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMMRKAIRGHL---ENNPQ 74
            |.:|..||       ||....|:.:.::::||.:.:. :.:..|||.:|..|: |..   |....
Human    26 LIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKH-SRMFFGKNKVMMVAL-GRSPSDEYKDN 88

  Fly    75 LEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPLHVIIPAQNTGLGPEKTSFF- 138
            |.::...::|.||.:||.....||.:...:......||.|..|       |....|.|.....| 
Human    89 LHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKA-------AFTVSLDPGPLEQFP 146

  Fly   139 -------QALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIVNQVYDSG 196
                   :.|.:||.:.:|.:.:::|..:.|.||.:...:|.:|.:.......:.:.:..::||.
Human   147 HSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQ 211

  Fly   197 SIFSPEILDIKPE 209
            |....::.|..||
Human   212 SGRFQQMGDDLPE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP0NP_001262202.1 PTZ00135 1..275 CDD:240285 48/208 (23%)
Ribosomal_P0_L10e 8..182 CDD:240221 42/179 (23%)
Ribosomal_60s 232..>285 CDD:278836
MRTO4NP_057267.2 Ribosomal_P0_like 21..183 CDD:240222 40/165 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..239 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.