DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP0 and RpLP2

DIOPT Version :10

Sequence 1:NP_524211.1 Gene:RpLP0 / 40451 FlyBaseID:FBgn0000100 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster


Alignment Length:43 Identity:27/43 - (62%)
Similarity:30/43 - (69%) Gaps:3/43 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 AAASASAAPAAGGATEKKEEAKKPE--SESEEEDDDMGFGLFD 317
            |.|:|.|||||....:|| ||||.|  .|||.|||||||.||:
  Fly    72 AVAAADAAPAAAAGGDKK-EAKKEEKKEESESEDDDMGFALFE 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP0NP_524211.1 PTZ00135 1..275 CDD:240285
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.