DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP0 and Mrto4

DIOPT Version :9

Sequence 1:NP_001262202.1 Gene:RpLP0 / 40451 FlyBaseID:FBgn0000100 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_006239240.1 Gene:Mrto4 / 298586 RGDID:1311709 Length:240 Species:Rattus norvegicus


Alignment Length:308 Identity:63/308 - (20%)
Similarity:105/308 - (34%) Gaps:111/308 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LFDEFPKC-------FIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMMRKAIRGHL---ENNPQ 74
            |.:|..||       ||....|:.:.::::||.:.:. :.:..|||.:|..|: |..   |....
  Rat    26 LIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKH-SRMFFGKNKVMMVAL-GRSPSDEYKDN 88

  Fly    75 LEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPLHVIIPAQNTGLGPEKTSF-- 137
            |.::...::|.||.:||.....||.:...:......||.|..|.|.|.:..     ||.| .|  
  Rat    89 LHQVSKKLRGEVGLLFTNRTKEEVNEWFTKYTEMDFARAGNKATLTVSLDP-----GPLK-QFPH 147

  Fly   138 -----FQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIVNQVYDSGS 197
                 .:.|.:||.:.||.:.:::|..:.|.||.:...:|.:|.:.......:.:.:..::|:.|
  Rat   148 SMEPQLRQLGLPTALKKGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDAQS 212

  Fly   198 IFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPHSIANGFKNLLAIAATTEVEFKEA 262
                           .:|||...:|.           .|||.|                      
  Rat   213 ---------------GRFQQMDDDLP-----------ESAPES---------------------- 229

  Fly   263 TTIKEYIKDPSKFAAAASASAAPAAGGATEKKEEAKKPESESEEEDDD 310
                                                  |.|||||:||
  Rat   230 --------------------------------------EGESEEEEDD 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP0NP_001262202.1 PTZ00135 1..275 CDD:240285 55/271 (20%)
Ribosomal_P0_L10e 8..182 CDD:240221 45/178 (25%)
Ribosomal_60s 232..>285 CDD:278836 4/52 (8%)
Mrto4XP_006239240.1 Ribosomal_P0_like 21..183 CDD:240222 43/164 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.