DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP0 and Rplp0l1

DIOPT Version :9

Sequence 1:NP_001262202.1 Gene:RpLP0 / 40451 FlyBaseID:FBgn0000100 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_227546.4 Gene:Rplp0l1 / 295340 RGDID:1564469 Length:315 Species:Rattus norvegicus


Alignment Length:322 Identity:187/322 - (58%)
Similarity:234/322 - (72%) Gaps:12/322 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGK-NTMMRKA 64
            |.||::...|:.||:|:::|.|::|||||:|||||.|||||.||.||:|.|||||.| |.|||||
  Rat     1 MPREDRVTCKSNYFLKIIQLLDDYPKCFIMGADNVSSKQMQQIRMSLQGKAVVLMIKNNAMMRKA 65

  Fly    65 IRGHLENNPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPLHVIIPAQNTG 129
            ||.|||.|..||||.||.:|||||:|||.||.|:||.||.:||.|..:.||:||..|...|||||
  Rat    66 IREHLEKNRALEKLPPHTRGNVGFMFTKEDLTEIRDMLLTNKVPAATQAGALAPCEVTAHAQNTG 130

  Fly   130 LGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIVNQVYD 194
            ||||||||||.|.|.||||:|.|||::||.::|.|:||||.||||   |||||...|||:.||:|
  Rat   131 LGPEKTSFFQVLGINTKISRGIIEILSDVQLIKTGNKVGAGEATL---LNISPSVSGLIIRQVFD 192

  Fly   195 SGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPHSIANGFKNLLAIAATTEVEF 259
            :|||::||:|||..:.||:.|.:||.|:|||||.:|.||:.|.||||.||.|.:||::..|:..|
  Rat   193 NGSIYNPEVLDITEQILRSHFLEGVRNVAAVCLQIGEPTVTSVPHSIINGSKRVLALSVETDYTF 257

  Fly   260 KEATTIKEYIKDPSKFAA----AASASAAPAAGGATEKKEEAKKPESESEEEDDDMGFGLFD 317
            ..|..:|.::.|||.|||    ||:.:|||||..|..|    .|.:.||||.|:|:.|||||
  Rat   258 PLAEKVKAFLADPSAFAAAAPVAAATTAAPAAAAAPAK----AKAKEESEESDEDVRFGLFD 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP0NP_001262202.1 PTZ00135 1..275 CDD:240285 163/274 (59%)
Ribosomal_P0_L10e 8..182 CDD:240221 113/174 (65%)
Ribosomal_60s 232..>285 CDD:278836 25/56 (45%)
Rplp0l1XP_227546.4 Ribosomal_P0_L10e 10..180 CDD:240221 113/172 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I7822
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 434 1.000 Inparanoid score I1646
OMA 1 1.010 - - QHG62173
OrthoDB 1 1.010 - - D1102823at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100781
Panther 1 1.100 - - O PTHR45699
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1858
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.