DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP0 and mrt4

DIOPT Version :9

Sequence 1:NP_001262202.1 Gene:RpLP0 / 40451 FlyBaseID:FBgn0000100 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_595721.1 Gene:mrt4 / 2539913 PomBaseID:SPBC11G11.03 Length:241 Species:Schizosaccharomyces pombe


Alignment Length:220 Identity:64/220 - (29%)
Similarity:95/220 - (43%) Gaps:29/220 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMMRKAI-----RGHL 69
            ||..|..|.:..|.|...:|....|:.:..::.||...:| :.:.|||..:|.||:     ..|.
pombe    23 KAALFSGVQQSLDSFDYMWIFDVTNMRNTYLKRIRDDWKG-SRIFMGKTKVMAKALGHTPEEEHA 86

  Fly    70 ENNPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAP-ARPGAIAPLHVIIPA----QNTG 129
            ||..:|.|||   .|.||.:||.....||.. ..||.|:.. ||.||:||...:|||    ...|
pombe    87 ENVSKLTKLL---HGAVGLLFTNSKPDEVIG-YFESFVQNDFARAGAVAPFTHVIPAGPVYSRAG 147

  Fly   130 LGPEKTSFF---------QALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLNI--SPF 183
            ..|.:....         :.|.:||.:..|.:.::.|.|:...|.::.:.:..||.:..|  :.|
pombe   148 QIPVEDDILLTHTLEPQVRQLGMPTVLKNGVVTLLADFPLCTEGQQLDSRQTRLLKLFGITAAEF 212

  Fly   184 SYGLIVNQVYDSGSIFSPEILDIKP 208
            ..||:   .|.|....|.|.|...|
pombe   213 KVGLL---GYYSKKGASVEFLQSAP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP0NP_001262202.1 PTZ00135 1..275 CDD:240285 64/220 (29%)
Ribosomal_P0_L10e 8..182 CDD:240221 55/192 (29%)
Ribosomal_60s 232..>285 CDD:278836
mrt4NP_595721.1 Ribosomal_P0_like 21..195 CDD:240222 52/176 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.