DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP0 and F10E7.5

DIOPT Version :9

Sequence 1:NP_001262202.1 Gene:RpLP0 / 40451 FlyBaseID:FBgn0000100 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_495470.1 Gene:F10E7.5 / 174168 WormBaseID:WBGene00017347 Length:220 Species:Caenorhabditis elegans


Alignment Length:176 Identity:45/176 - (25%)
Similarity:75/176 - (42%) Gaps:15/176 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMMRKAIRGHLENNP---QLEKLLPHIK 83
            |::...||....|:.|.:...||...:..:....|||.::..|: |..:::.   ||.|....:|
 Worm    35 DQYKNLFIFTIANMRSTRFIAIRQKYKENSRFFFGKNNVISIAL-GKQKSDEYANQLHKASAILK 98

  Fly    84 GNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPLHVIIPAQNTGLGPEKTSFF------QALS 142
            |..|.:||.....||..:..|:.....||.|.:|...|::|.     ||.....|      :.|.
 Worm    99 GQCGLMFTNMSKKEVEAEFSEASEEDYARVGDVATETVVLPE-----GPISQFAFSMEPQLRKLG 158

  Fly   143 IPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLI 188
            :|||:.||.|.:.....:.|.|:.:...:|.:|....:....:.||
 Worm   159 LPTKLDKGVITLYQQFEVCKEGEPLTVEQAKILKHFEVKMSQFRLI 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP0NP_001262202.1 PTZ00135 1..275 CDD:240285 45/176 (26%)
Ribosomal_P0_L10e 8..182 CDD:240221 43/168 (26%)
Ribosomal_60s 232..>285 CDD:278836
F10E7.5NP_495470.1 Ribosomal_P0_like 24..184 CDD:240222 41/154 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.