DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP0 and AgaP_AGAP007644

DIOPT Version :9

Sequence 1:NP_001262202.1 Gene:RpLP0 / 40451 FlyBaseID:FBgn0000100 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_308224.3 Gene:AgaP_AGAP007644 / 1269581 VectorBaseID:AGAP007644 Length:293 Species:Anopheles gambiae


Alignment Length:328 Identity:63/328 - (19%)
Similarity:115/328 - (35%) Gaps:108/328 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMMR---KAIRGHLEN 71
            |.|....:.:..:::...|:....|:.:.:::::|...:. :....|||.:|:   |.|.....:
Mosquito    23 KQQIIEDIQQCREKYDNIFLFSVQNMRNSKLKDVRAEWKN-SRFFFGKNRVMQLGLKLISDDENS 86

  Fly    72 NPQ-----LEKLLPHIKGNVGFVFTKGDLAEVRDKLLE----------------SKVRAPARPGA 115
            .|.     :|:|...:.|..|.:||    :|.:..:||                :......:||.
Mosquito    87 EPTKLEQGMEQLREQMIGQCGLLFT----SESKKTVLEWFDTYQAEEFARGGFRATKTVKLKPGP 147

  Fly   116 IAPL-HVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLN 179
            :... |.|.|            ..::|.:|||:.:|.:.:..:..:.:.|..:...:|.:|.:||
Mosquito   148 LEEFSHAIEP------------HLRSLGMPTKLDRGIVTLYKEFTVCEKGKVLTPEQARILKLLN 200

  Fly   180 ISPFSYGLIVNQVYDSGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPHSIANG 244
            ....::.||:|..|..                                              .:|
Mosquito   201 KPMATFKLIINCCYTK----------------------------------------------KDG 219

  Fly   245 FKNLL--AIAATTEVEFKEATTIKEYIKDPSKFAAAASASAAPAAGGATEKKEEAKKPESESEEE 307
            |:.:.  .||||.    |.:.|.|:    |:|          ||......||.:....|.|.|||
Mosquito   220 FEEITKREIAATK----KTSKTAKQ----PTK----------PATVAKKGKKTDDAMSEDEEEEE 266

  Fly   308 DDD 310
            |||
Mosquito   267 DDD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP0NP_001262202.1 PTZ00135 1..275 CDD:240285 50/291 (17%)
Ribosomal_P0_L10e 8..182 CDD:240221 36/196 (18%)
Ribosomal_60s 232..>285 CDD:278836 11/54 (20%)
AgaP_AGAP007644XP_308224.3 Ribosomal_P0_like 22..189 CDD:240222 32/182 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.