DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and SCJ1

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_013941.2 Gene:SCJ1 / 855254 SGDID:S000004827 Length:377 Species:Saccharomyces cerevisiae


Alignment Length:159 Identity:45/159 - (28%)
Similarity:74/159 - (46%) Gaps:33/159 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKDYYKILGIERNASSEDVKKGYRRMALRYHPDKN-DHPQAEEQFREVVAAFEVLFDKEKREIY 64
            :.:|||.||.|:::|:.:::|..||:::.:|||||| ...:|.::|.||..|::||.|.||::||
Yeast    20 LAQDYYAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIY 84

  Fly    65 DQHGEEGLK-----------------------------CDDEPAATFAQPTPDMLPFMCAVGGTV 100
            ||.|.:.:|                             ....|...|.|......|.:.......
Yeast    85 DQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMFQGGHGGPGGGFGQRQRQRGPMIKVQEKLS 149

  Fly   101 LFAFAAYKTFQF---FNRKKEATHGDGSS 126
            |..|.:..:.:|   .|.:.:|.||.||:
Yeast   150 LKQFYSGSSIEFTLNLNDECDACHGSGSA 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 27/61 (44%)
SCJ1NP_013941.2 DnaJ 21..377 CDD:223560 45/158 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.