DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and JJJ2

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_012373.2 Gene:JJJ2 / 853277 SGDID:S000003698 Length:583 Species:Saccharomyces cerevisiae


Alignment Length:155 Identity:42/155 - (27%)
Similarity:68/155 - (43%) Gaps:37/155 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYDQHGE 69
            ||.|||:..||:|.:|.|.|.::|...||||....::||.|:.||.|..:|.|::::..||:..:
Yeast    14 YYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEELFKAVVHAHSILTDEDQKLRYDRDLK 78

  Fly    70 -EGL--------------KCDDEPAAT---------FAQPTP-DMLPFMCAVGGTVL-------- 101
             :||              |..:...|:         ..|..| :..|:...||..:.        
Yeast    79 IKGLHTYQPKKNCHIFKTKAKESQGASPTLGQSEAYHRQNKPYEQQPYGFGVGKKMTSSSKSKVP 143

  Fly   102 ----FAFAAYKTFQFFNRKKEATHG 122
                |...:|:...:::.|||..||
Yeast   144 IFKSFNLKSYQRNHYYSSKKERKHG 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 24/59 (41%)
JJJ2NP_012373.2 DnaJ 13..74 CDD:395170 24/59 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.