DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and XDJ1

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_013191.1 Gene:XDJ1 / 850779 SGDID:S000004080 Length:459 Species:Saccharomyces cerevisiae


Alignment Length:131 Identity:43/131 - (32%)
Similarity:67/131 - (51%) Gaps:30/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKDYYKILGIERNASSEDVKKGYRRMALRYHPDK---NDHPQAEE-QFREVVAAFEVLFDKEKRE 62
            |...|.:||:.|:|:.:::|..||::||::||||   .|..:..| :|:|:.||:|:|.|.||:.
Yeast     7 GDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKKS 71

  Fly    63 IYDQHGEEGLKCDDEPAATFAQPTPDMLPFMCAVGGTVLFAFAAYKTF--QFFNRKKEATHGDGS 125
            .||.:|      ||..||              :.||...|....:..|  .|||   ..:| ||:
Yeast    72 HYDLYG------DDNGAA--------------SSGGANGFGDEDFMNFFNNFFN---NGSH-DGN 112

  Fly   126 S 126
            :
Yeast   113 N 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 25/64 (39%)
XDJ1NP_013191.1 DnaJ 11..379 CDD:223560 42/127 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.