DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and ERJ5

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_116699.3 Gene:ERJ5 / 850602 SGDID:S000001937 Length:295 Species:Saccharomyces cerevisiae


Alignment Length:70 Identity:21/70 - (30%)
Similarity:44/70 - (62%) Gaps:4/70 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIER--NASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYDQ 66
            ::||.|.:.:  |:|::::.|..|:::.:||||||  |:..:.:..:..|.::|.:...|:|||.
Yeast    44 NFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKN--PKYRKLYERLNLATQILSNSSNRKIYDY 106

  Fly    67 HGEEG 71
            :.:.|
Yeast   107 YLQNG 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 18/62 (29%)
ERJ5NP_116699.3 CbpA 41..271 CDD:225124 21/70 (30%)
DnaJ 44..105 CDD:395170 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.