DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and AT2G33735

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001325042.1 Gene:AT2G33735 / 817939 AraportID:AT2G33735 Length:119 Species:Arabidopsis thaliana


Alignment Length:65 Identity:24/65 - (36%)
Similarity:44/65 - (67%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIERNASSEDVKKGYRRMALRYHPDK-NDHPQAEEQFREVVAAFEVLFDKEKREIYDQ 66
            ||:||:|.:..:||.::::..:.|:||::|||| .:...|..:|:|:..|::||.|...|:.||:
plant    21 KDHYKVLELNCDASDDEIRSSFIRLALKWHPDKFKEEDSATSRFQEINEAYQVLSDPIARQEYDK 85

  Fly    67  66
            plant    86  85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 21/61 (34%)
AT2G33735NP_001325042.1 DnaJ 22..84 CDD:365959 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.