powered by:
Protein Alignment CG7130 and AT2G33735
DIOPT Version :9
Sequence 1: | NP_649380.1 |
Gene: | CG7130 / 40450 |
FlyBaseID: | FBgn0037151 |
Length: | 128 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001325042.1 |
Gene: | AT2G33735 / 817939 |
AraportID: | AT2G33735 |
Length: | 119 |
Species: | Arabidopsis thaliana |
Alignment Length: | 65 |
Identity: | 24/65 - (36%) |
Similarity: | 44/65 - (67%) |
Gaps: | 1/65 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KDYYKILGIERNASSEDVKKGYRRMALRYHPDK-NDHPQAEEQFREVVAAFEVLFDKEKREIYDQ 66
||:||:|.:..:||.::::..:.|:||::|||| .:...|..:|:|:..|::||.|...|:.||:
plant 21 KDHYKVLELNCDASDDEIRSSFIRLALKWHPDKFKEEDSATSRFQEINEAYQVLSDPIARQEYDK 85
Fly 67 66
plant 86 85
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7130 | NP_649380.1 |
DnaJ |
4..65 |
CDD:278647 |
21/61 (34%) |
AT2G33735 | NP_001325042.1 |
DnaJ |
22..84 |
CDD:365959 |
21/61 (34%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.