DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and dnajb14

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001071255.1 Gene:dnajb14 / 792752 ZFINID:ZDB-GENE-061110-138 Length:380 Species:Danio rerio


Alignment Length:156 Identity:48/156 - (30%)
Similarity:75/156 - (48%) Gaps:47/156 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYDQH 67
            |:||::|||.::||.:::||.||::||::|||||..|.|.:.|:::..|:.||.:.||:..||..
Zfish   110 KNYYEVLGIRKDASDDELKKAYRQLALKFHPDKNHAPGATDAFKKIGNAYSVLSNPEKKRQYDLS 174

  Fly    68 GEEGLKCDDEPAATFAQPTP----------------DMLP---FMCAVGGTVLFAFAAYKTFQFF 113
            |.|      ||:      ||                |:.|   |....||    :|.:..:.:|.
Zfish   175 GGE------EPS------TPNYSSHEGFDFHRGFESDITPEDLFNMFFGG----SFPSSNSHEFT 223

  Fly   114 NRKKEATH------------GDGSSS 127
            |.:..:.|            |||..|
Zfish   224 NGRTYSHHTEETRGERVEERGDGGFS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 26/60 (43%)
dnajb14NP_001071255.1 DnaJ 110..>218 CDD:223560 41/123 (33%)
DnaJ 111..172 CDD:278647 26/60 (43%)
DUF1977 272..372 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.