powered by:
Protein Alignment CG7130 and Dnajc5
DIOPT Version :9
Sequence 1: | NP_649380.1 |
Gene: | CG7130 / 40450 |
FlyBaseID: | FBgn0037151 |
Length: | 128 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_077075.1 |
Gene: | Dnajc5 / 79130 |
RGDID: | 620516 |
Length: | 198 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 36/72 - (50%) |
Similarity: | 56/72 - (77%) |
Gaps: | 1/72 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 GKDYYKILGIERNASSEDVKKGYRRMALRYHPDKN-DHPQAEEQFREVVAAFEVLFDKEKREIYD 65
|:..|.:||:::||:|:|:||.||::||:|||||| |:|:|.::|:|:..|..:|.|..||.|||
Rat 13 GESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYD 77
Fly 66 QHGEEGL 72
::|..||
Rat 78 KYGSLGL 84
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7130 | NP_649380.1 |
DnaJ |
4..65 |
CDD:278647 |
30/61 (49%) |
Dnajc5 | NP_077075.1 |
DnaJ |
15..>84 |
CDD:223560 |
33/68 (49%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
2 | 1.870 |
|
Return to query results.
Submit another query.