powered by:
Protein Alignment CG7130 and zgc:122979
DIOPT Version :9
Sequence 1: | NP_649380.1 |
Gene: | CG7130 / 40450 |
FlyBaseID: | FBgn0037151 |
Length: | 128 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001032663.2 |
Gene: | zgc:122979 / 641576 |
ZFINID: | ZDB-GENE-051127-45 |
Length: | 360 |
Species: | Danio rerio |
Alignment Length: | 65 |
Identity: | 33/65 - (50%) |
Similarity: | 50/65 - (76%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DYYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYDQHG 68
|||.:||:..:::.|:::|.|:|:|||||||||....||::|:::..|::||.|.|||.||||.|
Zfish 51 DYYSVLGVSNDSNEEEIRKAYKRLALRYHPDKNSDADAEDKFKQIAQAYDVLTDPEKRNIYDQQG 115
Fly 69 68
Zfish 116 115
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7130 | NP_649380.1 |
DnaJ |
4..65 |
CDD:278647 |
29/60 (48%) |
zgc:122979 | NP_001032663.2 |
DnaJ |
50..355 |
CDD:223560 |
33/65 (51%) |
DnaJ |
51..112 |
CDD:278647 |
29/60 (48%) |
DnaJ_C |
185..345 |
CDD:199909 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000274 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.900 |
|
Return to query results.
Submit another query.