DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and DNAJB11

DIOPT Version :10

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_057390.1 Gene:DNAJB11 / 51726 HGNCID:14889 Length:358 Species:Homo sapiens


Alignment Length:73 Identity:44/73 - (60%)
Similarity:62/73 - (84%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKDYYKILGIERNASSEDVKKGYRRMALRYHPDKN-DHPQAEEQFREVVAAFEVLFDKEKREIYD 65
            |:|:|||||:.|:||.:|:||.||::||:.|||:| |.|||:|:|:::.||:|||.|.|||:.||
Human    23 GRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYD 87

  Fly    66 QHGEEGLK 73
            .:||||||
Human    88 TYGEEGLK 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ_bact 4..>73 CDD:274090 41/69 (59%)
DNAJB11NP_057390.1 DnaJ_bact 25..345 CDD:274090 43/71 (61%)

Return to query results.
Submit another query.