DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and CG5504

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster


Alignment Length:70 Identity:33/70 - (47%)
Similarity:50/70 - (71%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKDYYKILGIERNASSEDVKKGYRRMALRYHPDKN-DHPQAEEQFREVVAAFEVLFDKEKREIY 64
            :.||||..||:.:||:.:|:||.|.::|.:||||.| :.|.|..:|:||..|:|||.|::||..|
  Fly    62 LAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREY 126

  Fly    65 DQHGE 69
            |.:|:
  Fly   127 DTYGQ 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 29/61 (48%)
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 33/69 (48%)
DnaJ 65..127 CDD:278647 29/61 (48%)
DnaJ_zf 227..287 CDD:199908
DnaJ_C 288..409 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.