DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and dnajb1a

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001003571.1 Gene:dnajb1a / 445177 ZFINID:ZDB-GENE-040801-90 Length:335 Species:Danio rerio


Alignment Length:114 Identity:51/114 - (44%)
Similarity:72/114 - (63%) Gaps:16/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKDYYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYD 65
            ||||||:|||||:.||.|::||.||:.|||:|||||....||::|:|:..|::||.|.:|::|||
Zfish     1 MGKDYYRILGIEKGASDEEIKKAYRKQALRFHPDKNKSAGAEDKFKEIAEAYDVLSDAKKKDIYD 65

  Fly    66 QHGEEGLK-------------CDDEPAATFAQPTPDMLP---FMCAVGG 98
            ::||:|||             ...:|.|.||:......|   |..:.||
Zfish    66 RYGEDGLKGHAGSGTNGPSYTFHGDPHAMFAEFFGGRSPFDHFFASAGG 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 33/60 (55%)
dnajb1aNP_001003571.1 DnaJ 1..335 CDD:223560 51/114 (45%)
DnaJ 4..65 CDD:278647 33/60 (55%)
DnaJ_C 157..321 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.