DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and dnajb4

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001003455.1 Gene:dnajb4 / 445061 ZFINID:ZDB-GENE-040801-192 Length:340 Species:Danio rerio


Alignment Length:145 Identity:63/145 - (43%)
Similarity:76/145 - (52%) Gaps:35/145 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKDYYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYD 65
            |||||||||||.:.||.:|:||.||:.||::|||||....|||:|:||..|:|||.|.:||||||
Zfish     1 MGKDYYKILGITKGASDDDIKKAYRKQALKWHPDKNKAANAEEKFKEVAEAYEVLSDPKKREIYD 65

  Fly    66 QHGEEGLK----CDDEPAATFAQPTPDMLPFMCAVGGTVLFAF-----AAYKTF--------QFF 113
            |:||||||    ..|.|                  ||...:.|     |.:.||        .||
Zfish    66 QYGEEGLKGGGGASDGP------------------GGNFTYTFHGDPHATFATFFGGASPFEVFF 112

  Fly   114 NRKKEATHGDGSSSD 128
            .||......|....|
Zfish   113 GRKVNGRDEDDMEVD 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 37/60 (62%)
dnajb4NP_001003455.1 DnaJ 1..334 CDD:223560 63/145 (43%)
DnaJ 4..65 CDD:278647 37/60 (62%)
DnaJ_C 163..325 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594964
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.