DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and dnajb6

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:XP_012819877.1 Gene:dnajb6 / 394712 XenbaseID:XB-GENE-972413 Length:336 Species:Xenopus tropicalis


Alignment Length:127 Identity:53/127 - (41%)
Similarity:75/127 - (59%) Gaps:17/127 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIERNASSEDVKKGYRRMALRYHPDKN--DHPQAEEQFREVVAAFEVLFDKEKREIYDQ 66
            :||.:||::||||.||:||.||::||::|||||  :..:||.:|:||..|:|||.|.:||:|||:
 Frog     3 EYYDVLGVQRNASPEDIKKAYRKLALKWHPDKNPDNKDEAERRFKEVAEAYEVLSDSKKRDIYDK 67

  Fly    67 HGEEGLKCD------DEP---AATFAQPTPDMLPFMCAVGGTVLFAFAAYKT---FQFFNRK 116
            :|:|||...      |.|   ..||..|......|.   ||...|:|..:..   ..||.|:
 Frog    68 YGKEGLTGGGGGSHFDNPYEFGFTFRSPDDVFRDFF---GGRDPFSFDLFADDPFDDFFGRR 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 34/62 (55%)
dnajb6XP_012819877.1 DnaJ 3..66 CDD:278647 34/62 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.