DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and DNAJB13

DIOPT Version :10

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:XP_011543306.1 Gene:DNAJB13 / 374407 HGNCID:30718 Length:350 Species:Homo sapiens


Alignment Length:60 Identity:29/60 - (48%)
Similarity:45/60 - (75%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYDQHGEEGLK 73
            ::::||..:.|||:||::||.|::.|.:.|.||::..|::||.|..||.|||:.||||||
Human    48 HSTAEDKDQRYRRLALKHHPLKSNEPSSAEIFRQIAEAYDVLSDPMKRGIYDKFGEEGLK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ_bact 4..>73 CDD:274090 27/58 (47%)
DNAJB13XP_011543306.1 PTZ00037 42..345 CDD:240236 29/60 (48%)

Return to query results.
Submit another query.