powered by:
Protein Alignment CG7130 and Dnajc5g
DIOPT Version :9
Sequence 1: | NP_649380.1 |
Gene: | CG7130 / 40450 |
FlyBaseID: | FBgn0037151 |
Length: | 128 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017449734.1 |
Gene: | Dnajc5g / 366567 |
RGDID: | 1307426 |
Length: | 186 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 35/72 - (48%) |
Similarity: | 51/72 - (70%) |
Gaps: | 1/72 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 GKDYYKILGIERNASSEDVKKGYRRMALRYHPDKN-DHPQAEEQFREVVAAFEVLFDKEKREIYD 65
||..|.:|.:::.|..|::||.||::||:|||||| .:.||.|.|:::.||..||.|..|::|||
Rat 15 GKSLYAVLELKKGAQPEEIKKAYRKLALQYHPDKNPGNSQAAEFFKDINAAHAVLTDPTKKKIYD 79
Fly 66 QHGEEGL 72
:||..||
Rat 80 RHGSLGL 86
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7130 | NP_649380.1 |
DnaJ |
4..65 |
CDD:278647 |
27/61 (44%) |
Dnajc5g | XP_017449734.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
3 | 2.870 |
|
Return to query results.
Submit another query.