powered by:
Protein Alignment CG7130 and dnj-19
DIOPT Version :9
Sequence 1: | NP_649380.1 |
Gene: | CG7130 / 40450 |
FlyBaseID: | FBgn0037151 |
Length: | 128 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_504452.1 |
Gene: | dnj-19 / 3565862 |
WormBaseID: | WBGene00001037 |
Length: | 439 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 30/68 - (44%) |
Similarity: | 43/68 - (63%) |
Gaps: | 2/68 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 YKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYDQHGEE 70
|..|.:..:||..|:||.|.::|..|||||| |...::|:|:..|:|||...|||.:||..|.|
Worm 15 YTTLNVRPDASQADIKKSYFKLAKEYHPDKN--PDHGDKFKEISFAYEVLSSPEKRRLYDARGLE 77
Fly 71 GLK 73
|::
Worm 78 GVQ 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.