DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and CG5001

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster


Alignment Length:109 Identity:53/109 - (48%)
Similarity:71/109 - (65%) Gaps:17/109 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKDYYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYD 65
            ||||||||||:.:.|:.:::||.||::|||||||||....||::|:||..|:|||.||.|||:||
  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65

  Fly    66 QHGEEGLKC-----------------DDEPAATFAQPTPDMLPF 92
            ::||:|||.                 ..:|.|||||...:..||
  Fly    66 KYGEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPF 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 35/60 (58%)
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 53/109 (49%)
DnaJ 4..65 CDD:278647 35/60 (58%)
DnaJ_C 174..338 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458960
Domainoid 1 1.000 83 1.000 Domainoid score I435
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.