DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and shv

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster


Alignment Length:128 Identity:48/128 - (37%)
Similarity:68/128 - (53%) Gaps:25/128 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKDYYKILGIERNASSEDVKKGYRRMALRYHPDKN-DHPQAEEQFREVVAAFEVLFDKEKREIYD 65
            |:|:||||.:::||::.:|||.|||:|...||||| |.|.|..:|:::.||:|||.:.:||:.||
  Fly    23 GRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYD 87

  Fly    66 QHGEEGLKCDDEPAATFAQPTPDMLPFMCAVGGTVLFAFAAYKTFQFFNRKKEATHGDGSSSD 128
            :.|||.||.:.                |...||....:|.....|.|        .|||...|
  Fly    88 RCGEECLKKEG----------------MMDHGGDPFSSFFGDFGFHF--------GGDGQQQD 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 30/61 (49%)
shvNP_608525.1 DnaJ 22..346 CDD:223560 48/128 (38%)
DnaJ 25..87 CDD:278647 30/61 (49%)
DnaJ_C 131..328 CDD:199909
DnaJ_zf 160..>195 CDD:304418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458954
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.